WaStickerApps Christmas Stickers for whatsapp иконка

WaStickerApps Christmas Stickers for whatsapp

2.1 for Android
5.0 | 5,000+ Количество установок

Variety Apps 2021

Описание для WaStickerApps Christmas Stickers for whatsapp

Do you like to share WAStickerApps to congratulate the Christmas holidays in an original way?
Do you want to surprise with Christmas stickers to share on whatsapp?
Here you will find the best Merry Christmas 2020 stickers, we invite you to download them
This application is dedicated to our users who use our apps to congratulate their family and friends on the Christmas holidays.
It will help you express your emotions with your loved ones with amazing special stickers for the Christmas dates.
In this application you will find several free packs of stickers for WhatsApp such as:
🎅 Santa Claus
🧝 Christmas Elves
🦌 Cute animals
⛄ Snowman
🎄 Christmas Tree
🤶 Xmas emojis
✨ Christmas ornaments
🎁 Xmas gifts
🎊 Christmas balls
🔔 Xmas bells
Many of our friends already know this Christmas Stickers application for whatsapp that we have compiled with much love and feeling for YOU, friend or friend.
In this free application "WaStickerApps Christmas Stickers for whatsapp" we have used public domain images, however if any image is copyrighted, let us know to remove it immediately, we want to be honest and comply with the rules.
Thank you very much for your positive assessment, if you do not like something about this application send us a suggestion with an email before giving us a negative comment.
We want to improve and give you the applications you are looking for. Help us keep creating free apps for YOU.
- Christmas Wastickerapps are very easy to install, access the list of sticker packs, choose the one you want to install and click on the green button "Add to whatsapp"
located at the top of the screen, then you can access the birthday WAStickerapps within your whatsapp chat.
- You can also share the images by the means you have installed, facebook, instagram, whatsapp, email, etc, by directly selecting the image and giving it to share.
Finally, thank you for your download, thank you very much friend or friend from where you are in the world, a big hug!
P.D: We dedicate this application "WaStickerApps Christmas Stickers for whatsapp" to all the people who download our apps and share making a better world.
Enjoy sending stickers to congratulate your friends and family!
We wish you a happy Christmas season and a Happy New Year 2021

Информация

  • Категории:
    Развлечения
  • Последняя версия:
    2.1
  • Обновлено:
    2020-10-14
  • Размер файла:
    9.6MB
  • Требования:
    Android 4.1 или более поздняя
  • Обновлено:
    Variety Apps 2021
  • ID:
    com.varietyapps.wastickerappsmerrychristmas